PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G095500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28415.9 Da    PI: 6.8765
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G095500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.73.2e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+ rqvtf+kRrng+lKKA+ELS LCdaeva+iifs +g+l+e+ss
  Brast02G095500.1.p  9 KRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSS 59
                        79***********************************************96 PP

2K-box98.69.1e-33851711399
               K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                         ++e  +qe+ kLk ++e Lq++qR++lGedL++Ls+keL+q+e+q++ slk+iRs+Kn++ll+q+ +l++ke+elq++nk+Lrkkl+
  Brast02G095500.1.p  85 ESEINYQEYLKLKTRVEFLQSSQRNILGEDLGPLSMKELEQIENQIDISLKHIRSRKNQVLLDQLFDLKNKEQELQDQNKDLRKKLQ 171
                         456679*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.506161IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-39160IPR002100Transcription factor, MADS-box
CDDcd002652.39E-43278No hitNo description
SuperFamilySSF554554.84E-32281IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-313859IPR002100Transcription factor, MADS-box
PfamPF014866.7E-2886171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.5986176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGKVEMKR IENKISRQVT FAKRRNGLLK KAYELSLLCD AEVALIIFSG RGRLFEFSSS  60
SCMYKTLERY RTCNYNSQEA TPPVESEINY QEYLKLKTRV EFLQSSQRNI LGEDLGPLSM  120
KELEQIENQI DISLKHIRSR KNQVLLDQLF DLKNKEQELQ DQNKDLRKKL QDTSCGDNAL  180
HMSWQDGGQS SSSGHGNIEP YPGLLQRPDH DSSMQIGYQH PYMDQLNNED MASQDPNGHH  240
LGTSGWI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-249117222103Developmental protein SEPALLATA 3
4ox0_B2e-249117222103Developmental protein SEPALLATA 3
4ox0_C2e-249117222103Developmental protein SEPALLATA 3
4ox0_D2e-249117222103Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693060.0KF469306.1 Brachypodium distachyon MADS-box transcription factor 11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558496.11e-167PREDICTED: MADS-box transcription factor 1-like isoform X1
SwissprotQ10PZ91e-127MADS1_ORYSJ; MADS-box transcription factor 1
SwissprotA2XDY11e-127MADS1_ORYSI; MADS-box transcription factor 1
TrEMBLI1H8241e-167I1H824_BRADI; Uncharacterized protein
STRINGBRADI1G69890.11e-147(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22213264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.13e-78MIKC_MADS family protein